LL-37
LL-37
What is LL-37?
LL-37 is a 37-amino acid peptide derived from cathelicidin, a naturally occurring protein in human immune cells. As part of the body’s innate defense mechanism, LL-37 plays a crucial role in combating bacterial, viral, and fungal pathogens. Research highlights its broad-spectrum antimicrobial activity, ability to modulate immune responses, and its role in promoting wound healing and tissue repair. LL-37's antimicrobial properties extend to reducing biofilm formation, a major factor in chronic infections, making it an intriguing focus for ongoing studies into immune health and infection control.
Moreover, LL-37 has demonstrated the ability to influence cellular processes such as angiogenesis (the formation of new blood vessels), tissue regeneration, and inflammation modulation. These properties position LL-37 as a promising peptide for research into antimicrobial therapies, immune regulation, and regenerative medicine.
Derived from a naturally occurring protein in the immune system, synthetic LL-37 retains the vital functions of its natural counterpart, offering potential applications in infection management, chronic wound healing, and even inflammation-related disorders. Researchers continue to explore its potential in therapeutic applications, making LL-37 an exciting area of peptide science.
What Are the Effects of LL-37?
Broad-Spectrum Antimicrobial Activity
LL-37 exhibits potent antimicrobial properties, targeting bacteria, viruses, and fungi. Its mechanism involves binding to microbial membranes, destabilizing their structure, and neutralizing harmful pathogens. This makes LL-37 a subject of interest in research on antimicrobial resistance and chronic infections.
Reduces Biofilm Formation
Biofilms are structured communities of microorganisms that resist standard treatments. LL-37 has been shown to inhibit biofilm formation and disrupt existing biofilms, potentially improving outcomes in infections resistant to conventional antibiotics.
Supports Wound Healing and Tissue Repair
LL-37 promotes the regeneration of damaged tissues by enhancing angiogenesis and modulating inflammation. These effects make it a valuable peptide for research into chronic wound healing and regenerative medicine.
Modulates Immune Response
LL-37 helps regulate the immune system by balancing pro-inflammatory and anti-inflammatory responses. This modulation aids in reducing excessive inflammation while still supporting effective pathogen defense, offering potential insights into treatments for autoimmune and inflammatory disorders.
Anti-Inflammatory Effects
Studies have shown that LL-37 can suppress excessive inflammatory responses by interacting with immune signaling pathways. These properties make it a promising candidate for research into conditions involving chronic inflammation, such as arthritis or inflammatory bowel disease.
Potential Applications in Chronic Conditions
Emerging research suggests LL-37 may have therapeutic potential in addressing chronic infections, skin conditions like psoriasis, and even certain cancers. Its ability to influence both innate and adaptive immunity is driving interest in its broader applications.
Chemical Structure of LL-37 (5mg)
LL-37 is a linear cationic amphipathic peptide composed of 37 amino acids. Its amino acid sequence is as follows:
[LL-37, 37 aa]
This structure allows LL-37 to interact with microbial membranes, disrupting their integrity and neutralizing pathogens. Its unique sequence also underpins its immunomodulatory and regenerative properties.
Couldn't load pickup availability
In stock
DisclaimerThis product is not for human or veterinary use and should only be utilized by qualified researchers in a laboratory setting.
Keep this product out of the reach of children. This material has limited research available about it and may result in adverse effects if improperly handled or consumed. This product is not a dietary supplement, but a pure substance, sold as a raw material. We attest exclusively to the quality, purity and description of the materials we provide. This product is for use and handling only by persons with the knowledge and equipment to safely handle this material. You agree to indemnify us for any adverse effects that may arise from improper handling and/or consumption of this product.
All our products are for LABORATORY AND RESEARCH PURPOSES ONLY, not for veterinary or human usage. View full details
